PGM2L1 anticorps (N-Term)
-
- Antigène Voir toutes PGM2L1 Anticorps
- PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PGM2L1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PGM2 L1 antibody was raised against the N terminal of PGM2 1
- Purification
- Affinity purified
- Immunogène
- PGM2 L1 antibody was raised using the N terminal of PGM2 1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK
- Top Product
- Discover our top product PGM2L1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PGM2L1 Blocking Peptide, catalog no. 33R-4321, is also available for use as a blocking control in assays to test for specificity of this PGM2L1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PGM2L1 (phosphoglucomutase 2-Like 1 (PGM2L1))
- Autre désignation
- PGM2L1 (PGM2L1 Produits)
- Synonymes
- anticorps 4931406N15Rik, anticorps AI553438, anticorps BM32A, anticorps im:7140576, anticorps zgc:198285, anticorps pgm2l1, anticorps phosphoglucomutase 2-like 1, anticorps phosphoglucomutase 2 like 1, anticorps phosphoglucomutase 2-like 1 L homeolog, anticorps Pgm2l1, anticorps PGM2L1, anticorps pgm2l1, anticorps pgm2l1.L
- Sujet
- PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.
- Poids moléculaire
- 70 kDa (MW of target protein)
-