CCDC138 anticorps (N-Term)

N° du produit ABIN632125

Détail du produit anti-CCDC138 anticorps

Antigène: CCDC138 (Coiled-Coil Domain Containing 138 (CCDC138))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC138 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC138 antibody was raised against the N terminal of CCDC138

Purification: Affinity purified

Immunogène: CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC138 Blocking Peptide, catalog no. 33R-2646, is also available for use as a blocking control in assays to test for specificity of this CCDC138 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC138 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC138

Antigène: CCDC138 (Coiled-Coil Domain Containing 138 (CCDC138))

Autre désignation: CCDC138 (CCDC138 Produits)

Synonymes: anticorps 6230424H07Rik, anticorps BC042726, anticorps MGC115290, anticorps RGD1566050, anticorps coiled-coil domain containing 138, anticorps coiled-coil domain containing 138 L homeolog, anticorps Ccdc138, anticorps CCDC138, anticorps ccdc138.L, anticorps ccdc138

Sujet: The function of the CCDC138 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 76 kDa (MW of target protein)

Pathways: BCR Signaling