ANKMY2 anticorps (N-Term)

N° du produit ABIN632127

Cet anticorps anti-ANKMY2 est un anticorps Lapin Polyclonal détectant ANKMY2 dans WB. Adapté pour Humain.

Aperçu rapide pour ANKMY2 anticorps (N-Term) (ABIN632127)

Antigène: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANKMY2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ANKMY2 anticorps

Épitope: N-Term

Specificité: ANKMY2 antibody was raised against the N terminal of ANKMY2

Purification: Affinity purified

Immunogène: ANKMY2 antibody was raised using the N terminal of ANKMY2 corresponding to a region with amino acids DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANKMY2 Blocking Peptide, (ABIN937612), is also available for use as a blocking control in assays to test for specificity of this ANKMY2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKMY2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANKMY2

Antigène: ANKMY2 (Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2))

Autre désignation: ANKMY2

Sujet: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 49 kDa (MW of target protein)