Adenylate Kinase 5 anticorps (N-Term)

N° du produit ABIN632129

L’anticorps Lapin Polyclonal anti-Adenylate Kinase 5 a été validé pour WB. Il convient pour détecter Adenylate Kinase 5 dans des échantillons de Humain.

Aperçu rapide pour Adenylate Kinase 5 anticorps (N-Term) (ABIN632129)

Antigène: Adenylate Kinase 5 (AK5)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adenylate Kinase 5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Adenylate Kinase 5 anticorps

Épitope: N-Term

Specificité: AK5 antibody was raised against the N terminal of AK5

Purification: Affinity purified

Immunogène: AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AK5 Blocking Peptide, (ABIN938107), is also available for use as a blocking control in assays to test for specificity of this AK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Adenylate Kinase 5

Antigène: Adenylate Kinase 5 (AK5)

Autre désignation: AK5

Sujet: This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process