Adenylate Kinase 5 anticorps (N-Term)
-
- Antigène Voir toutes Adenylate Kinase 5 (AK5) Anticorps
- Adenylate Kinase 5 (AK5)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Adenylate Kinase 5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AK5 antibody was raised against the N terminal of AK5
- Purification
- Affinity purified
- Immunogène
- AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY
- Top Product
- Discover our top product AK5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AK5 Blocking Peptide, catalog no. 33R-2721, is also available for use as a blocking control in assays to test for specificity of this AK5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Adenylate Kinase 5 (AK5)
- Autre désignation
- AK5 (AK5 Produits)
- Synonymes
- anticorps AK6, anticorps AK 5, anticorps wu:fj63a06, anticorps adenylate kinase 5, anticorps AK5, anticorps Ak5, anticorps ADK5, anticorps ak5
- Sujet
- This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
- Poids moléculaire
- 62 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-