MAGEA6 anticorps (Middle Region)

N° du produit ABIN632131

Détail du produit anti-MAGEA6 anticorps

Antigène: MAGEA6 (Melanoma Antigen Family A, 6 (MAGEA6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEA6 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAGEA6 antibody was raised against the middle region of MAGEA6

Purification: Affinity purified

Immunogène: MAGEA6 antibody was raised using the middle region of MAGEA6 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEA6 Blocking Peptide, catalog no. 33R-1419, is also available for use as a blocking control in assays to test for specificity of this MAGEA6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEA6

Antigène: MAGEA6 (Melanoma Antigen Family A, 6 (MAGEA6))

Autre désignation: MAGEA6 (MAGEA6 Produits)

Synonymes: anticorps Mage-a6, anticorps CT1.6, anticorps MAGE-3b, anticorps MAGE3B, anticorps MAGE6, anticorps melanoma antigen, family A, 6, anticorps MAGE family member A6, anticorps Magea6, anticorps MAGEA6

Sujet: MAGEA6 gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls.

Poids moléculaire: 35 kDa (MW of target protein)