C7orf29 anticorps (Middle Region)

N° du produit ABIN632132

Détail du produit anti-C7orf29 anticorps

Antigène: C7orf29 (C7ORF29) (Chromosome 7 Open Reading Frame 29 (C7ORF29))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C7orf29 est non-conjugé

Application: Western Blotting (WB)

Specificité: C7 ORF29 antibody was raised against the middle region of C7 rf29

Purification: Affinity purified

Immunogène: C7 ORF29 antibody was raised using the middle region of C7 rf29 corresponding to a region with amino acids VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C7ORF29 Blocking Peptide, catalog no. 33R-9618, is also available for use as a blocking control in assays to test for specificity of this C7ORF29 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF29 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C7orf29

Antigène: C7orf29 (C7ORF29) (Chromosome 7 Open Reading Frame 29 (C7ORF29))

Autre désignation: C7ORF29 (C7ORF29 Produits)

Synonymes: anticorps C7orf29, anticorps ZBED6 C-terminal like, anticorps ZBED6CL

Sujet: The function of Chromosome 7 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 26 kDa (MW of target protein)