VGLL3 anticorps

N° du produit ABIN632133

Détail du produit anti-VGLL3 anticorps

Antigène: VGLL3 (Vestigial Like 3 (VGLL3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VGLL3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VGLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VGLL3 Blocking Peptide, catalog no. 33R-1663, is also available for use as a blocking control in assays to test for specificity of this VGLL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VGLL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VGLL3

Antigène: VGLL3 (Vestigial Like 3 (VGLL3))

Autre désignation: VGLL3 (VGLL3 Produits)

Synonymes: anticorps RGD1560030, anticorps VGL-3, anticorps VGL3, anticorps 1700110N18Rik, anticorps 4832416J22, anticorps C80713, anticorps Vgl-3, anticorps Vito-2, anticorps vestigial-like family member 3, anticorps vestigial like family member 3, anticorps Vgll3, anticorps VGLL3

Sujet: VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.

Poids moléculaire: 36 kDa (MW of target protein)