CCT8 anticorps

N° du produit ABIN632135

Détail du produit anti-CCT8 anticorps

Antigène: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCT8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCT8 Blocking Peptide, catalog no. 33R-2076, is also available for use as a blocking control in assays to test for specificity of this CCT8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCT8

Antigène: CCT8 (Chaperonin Containing TCP1, Subunit 8 (Theta) (CCT8))

Autre désignation: CCT8 (CCT8 Produits)

Synonymes: anticorps CCT8, anticorps DKFZp469C2223, anticorps MGC89698, anticorps C21orf112, anticorps Cctq, anticorps D21S246, anticorps PRED71, anticorps AI132397, anticorps Tcpq, anticorps fa22h09, anticorps wu:fa22h09, anticorps zgc:56059, anticorps chaperonin containing TCP1 subunit 8, anticorps chaperonin containing TCP1, subunit 8 (theta), anticorps chaperonin containing Tcp1, subunit 8 (theta), anticorps chaperonin containing TCP1 subunit 8 L homeolog, anticorps Chaperonin Containing TCP-1, anticorps CCT8, anticorps cct8, anticorps Cct8, anticorps cct8.L, anticorps cct-8

Sujet: As a molecular chaperone, CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.

Poids moléculaire: 59 kDa (MW of target protein)