PRMT7 anticorps (N-Term)

N° du produit ABIN632137

Détail du produit anti-PRMT7 anticorps

Antigène: PRMT7 (Protein Arginine Methyltransferase 7 (PRMT7))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRMT7 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRMT7 antibody was raised against the N terminal of PRMT7

Purification: Affinity purified

Immunogène: PRMT7 antibody was raised using the N terminal of PRMT7 corresponding to a region with amino acids MKIFCSRANPTTGSVEWLEEDEHYDYHQEIARSSYADMLHDKDRNVKYYQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRMT7 Blocking Peptide, catalog no. 33R-6141, is also available for use as a blocking control in assays to test for specificity of this PRMT7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRMT7

Antigène: PRMT7 (Protein Arginine Methyltransferase 7 (PRMT7))

Autre désignation: PRMT7 (PRMT7 Produits)

Synonymes: anticorps ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 7, anticorps ATPRMT7, anticorps DL4310W, anticorps FCAALL.195, anticorps protein arginine methyltransferase 7, anticorps RGD1304869, anticorps 4933402B05Rik, anticorps BC006705, anticorps zgc:66172, anticorps protein arginine methyltransferase 7, anticorps protein arginine methyltransferase 7 L homeolog, anticorps protein arginine N-methyltransferase 7, anticorps Protein arginine N-methyltransferase 7, anticorps PRMT7, anticorps Prmt7, anticorps prmt7.L, anticorps prmt7, anticorps prmt-7

Sujet: Arginine methylation is an apparently irreversible protein modification catalyzed by arginine methyltransferases, such as PMT7, using S-adenosylmethionine (AdoMet) as the methyl donor. Arginine methylation is implicated in signal transduction, RNA transport, and RNA splicing.

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization