RPESP anticorps (Middle Region)

N° du produit ABIN632147

L’anticorps anti-RPESP Polyclonal Lapin est utilisé pour la détection de RPESP dans des échantillons de Souris, Rat et Humain. Il a été validé pour WB.

Aperçu rapide pour RPESP anticorps (Middle Region) (ABIN632147)

Antigène: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPESP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPESP anticorps

Épitope: Middle Region

Specificité: RPESP antibody was raised against the middle region of RPESP

Purification: Affinity purified

Immunogène: RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPESP Blocking Peptide, (ABIN5615932), is also available for use as a blocking control in assays to test for specificity of this RPESP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPESP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPESP

Antigène: RPESP (C8orf84) (Chromosome 8 Open Reading Frame 84 (C8orf84))

Autre désignation: RPESP

Sujet: RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.

Poids moléculaire: 29 kDa (MW of target protein)