ITPK1 anticorps (N-Term)

N° du produit ABIN632148

Cet anticorps anti-ITPK1 est un anticorps Lapin Polyclonal détectant ITPK1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ITPK1 anticorps (N-Term) (ABIN632148)

Antigène: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITPK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ITPK1 anticorps

Épitope: N-Term

Specificité: ITPK1 antibody was raised against the N terminal of ITPK1

Purification: Affinity purified

Immunogène: ITPK1 antibody was raised using the N terminal of ITPK1 corresponding to a region with amino acids MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ITPK1 Blocking Peptide, (ABIN5614231), is also available for use as a blocking control in assays to test for specificity of this ITPK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITPK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITPK1

Antigène: ITPK1 (Inositol-Tetrakisphosphate 1-Kinase (ITPK1))

Autre désignation: ITPK1

Sujet: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. It probably acts as the rate-limiting enzyme of the InsP6 pathway. ITPK1 modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.

Poids moléculaire: 45 kDa (MW of target protein)