TADA1 anticorps

N° du produit ABIN632160

Cet anticorps anti-TADA1 est un anticorps Lapin Polyclonal détectant TADA1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour TADA1 anticorps (ABIN632160)

Antigène: TADA1 (Transcriptional Adaptor 1 (TADA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TADA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TADA1 anticorps

Purification: Affinity purified

Immunogène: TADA1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TADA1L Blocking Peptide, (ABIN5616494), is also available for use as a blocking control in assays to test for specificity of this TADA1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TADA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TADA1

Antigène: TADA1 (Transcriptional Adaptor 1 (TADA1))

Autre désignation: TADA1L

Sujet: TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation.

Poids moléculaire: 37 kDa (MW of target protein)