TADA1 anticorps
-
- Antigène Voir toutes TADA1 Anticorps
- TADA1 (Transcriptional Adaptor 1 (TADA1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TADA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TADA1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC
- Top Product
- Discover our top product TADA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TADA1L Blocking Peptide, catalog no. 33R-7893, is also available for use as a blocking control in assays to test for specificity of this TADA1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TADA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TADA1 (Transcriptional Adaptor 1 (TADA1))
- Autre désignation
- TADA1L (TADA1 Produits)
- Synonymes
- anticorps tada1l, anticorps MGC89522, anticorps TADA1L, anticorps DKFZp459M089, anticorps STAF42, anticorps zgc:85851, anticorps ADA1, anticorps HFI1, anticorps RP1-9E21.4, anticorps hADA1, anticorps 2900026B15Rik, anticorps D1Ertd251e, anticorps Staf42, anticorps Tada1l, anticorps RGD1306774, anticorps TADA1, anticorps transcriptional adaptor 1, anticorps transcriptional adaptor 1 L homeolog, anticorps tada1, anticorps TADA1, anticorps tada1.L, anticorps Tada1
- Sujet
- TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation.
- Poids moléculaire
- 37 kDa (MW of target protein)
-