TADA1 anticorps

N° du produit ABIN632160

Détail du produit anti-TADA1 anticorps

Antigène: TADA1 (Transcriptional Adaptor 1 (TADA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TADA1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TADA1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TADA1L Blocking Peptide, catalog no. 33R-7893, is also available for use as a blocking control in assays to test for specificity of this TADA1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TADA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TADA1

Antigène: TADA1 (Transcriptional Adaptor 1 (TADA1))

Autre désignation: TADA1L (TADA1 Produits)

Synonymes: anticorps tada1l, anticorps MGC89522, anticorps TADA1L, anticorps DKFZp459M089, anticorps STAF42, anticorps zgc:85851, anticorps ADA1, anticorps HFI1, anticorps RP1-9E21.4, anticorps hADA1, anticorps 2900026B15Rik, anticorps D1Ertd251e, anticorps Staf42, anticorps Tada1l, anticorps RGD1306774, anticorps TADA1, anticorps transcriptional adaptor 1, anticorps transcriptional adaptor 1 L homeolog, anticorps tada1, anticorps TADA1, anticorps tada1.L, anticorps Tada1

Sujet: TADA1L belongs to the TADA1L family.It is probably involved in transcriptional regulation.

Poids moléculaire: 37 kDa (MW of target protein)