EIF3E anticorps (N-Term)

N° du produit ABIN632164

Cet anticorps Lapin Polyclonal détecte spécifiquement EIF3E dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour EIF3E anticorps (N-Term) (ABIN632164)

Antigène: EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF3E est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EIF3E anticorps

Épitope: N-Term

Specificité: EIF3 E antibody was raised against the N terminal of EIF3

Purification: Affinity purified

Immunogène: EIF3 E antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF3E Blocking Peptide, (ABIN937943), is also available for use as a blocking control in assays to test for specificity of this EIF3E antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF3E

Antigène: EIF3E (Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E))

Autre désignation: EIF3E

Sujet: EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD), It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Hepatitis C