Tektin 4 anticorps (N-Term)

N° du produit ABIN632168

L’anticorps Lapin Polyclonal anti-Tektin 4 a été validé pour WB. Il convient pour détecter Tektin 4 dans des échantillons de Humain.

Aperçu rapide pour Tektin 4 anticorps (N-Term) (ABIN632168)

Antigène: Tektin 4 (TEKT4)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tektin 4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Tektin 4 anticorps

Épitope: N-Term

Specificité: Tektin 4 antibody was raised against the N terminal of TEKT4

Purification: Affinity purified

Immunogène: Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tektin 4 Blocking Peptide, (ABIN940188), is also available for use as a blocking control in assays to test for specificity of this Tektin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEKT4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tektin 4

Antigène: Tektin 4 (TEKT4)

Autre désignation: Tektin 4

Sujet: TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.

Poids moléculaire: 51 kDa (MW of target protein)