FAM217A anticorps (Middle Region)

N° du produit ABIN632181

Cet anticorps anti-FAM217A Polyclonal Lapin (ABIN632181) détecte spécifiquement FAM217A dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour FAM217A anticorps (Middle Region) (ABIN632181)

Antigène: FAM217A (Family with Sequence Similarity 217, Member A (FAM217A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM217A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM217A anticorps

Épitope: Middle Region

Specificité: C6 ORF146 antibody was raised against the middle region of C6 rf146

Purification: Affinity purified

Immunogène: C6 ORF146 antibody was raised using the middle region of C6 rf146 corresponding to a region with amino acids ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C6ORF146 Blocking Peptide, (ABIN938151), is also available for use as a blocking control in assays to test for specificity of this C6ORF146 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF146 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM217A

Antigène: FAM217A (Family with Sequence Similarity 217, Member A (FAM217A))

Autre désignation: C6ORF146

Sujet: The specific function of C6orf146 is not yet known.

Poids moléculaire: 57 kDa (MW of target protein)