TMOD3 anticorps

N° du produit ABIN632188

Détail du produit anti-TMOD3 anticorps

Antigène: TMOD3 (Tropomodulin 3 (TMOD3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMOD3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Tropomodulin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tropomodulin 3 Blocking Peptide, catalog no. 33R-4183, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMOD3

Antigène: TMOD3 (Tropomodulin 3 (TMOD3))

Autre désignation: Tropomodulin 3 (TMOD3 Produits)

Synonymes: anticorps TMOD3, anticorps tropomodulin-3, anticorps UTMOD, anticorps MGC53545, anticorps U-Tmod, anticorps tropomodulin 3, anticorps tropomodulin 3 S homeolog, anticorps TMOD3, anticorps Tmod3, anticorps tmod3.S, anticorps tmod3

Sujet: TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization