LYPLA2 anticorps (N-Term)

N° du produit ABIN632189

L’anticorps Lapin Polyclonal anti-LYPLA2 a été validé pour WB. Il convient pour détecter LYPLA2 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour LYPLA2 anticorps (N-Term) (ABIN632189)

Antigène: LYPLA2 (Lysophospholipase II (LYPLA2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYPLA2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LYPLA2 anticorps

Épitope: N-Term

Specificité: LYPLA2 antibody was raised against the N terminal of LYPLA2

Purification: Affinity purified

Immunogène: LYPLA2 antibody was raised using the N terminal of LYPLA2 corresponding to a region with amino acids MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYPLA2 Blocking Peptide, (ABIN5614614), is also available for use as a blocking control in assays to test for specificity of this LYPLA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPLA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYPLA2

Antigène: LYPLA2 (Lysophospholipase II (LYPLA2))

Autre désignation: LYPLA2

Sujet: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Poids moléculaire: 25 kDa (MW of target protein)