MGC48628 (N-Term) anticorps

N° du produit ABIN632193

Cet anticorps anti-MGC48628 Polyclonal Lapin (ABIN632193) détecte spécifiquement MGC48628 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour MGC48628 (N-Term) anticorps (ABIN632193)

Antigène: MGC48628

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: MGC48628 antibody was raised against the N terminal of MGC48628

Purification: Affinity purified

Immunogène: MGC48628 antibody was raised using the N terminal of MGC48628 corresponding to a region with amino acids HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC48628 Blocking Peptide, (ABIN939132), is also available for use as a blocking control in assays to test for specificity of this MGC48628 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC48628 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: MGC48628

Sujet: The function of MGC48628 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 74 kDa (MW of target protein)