WBP2 anticorps (N-Term)

N° du produit ABIN632196

Détail du produit anti-WBP2 anticorps

Antigène: WBP2 (WW Domain Binding Protein 2 (WBP2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WBP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: WBP2 antibody was raised against the N terminal of WBP2

Purification: Affinity purified

Immunogène: WBP2 antibody was raised using the N terminal of WBP2 corresponding to a region with amino acids MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WBP2 Blocking Peptide, catalog no. 33R-6156, is also available for use as a blocking control in assays to test for specificity of this WBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WBP2

Antigène: WBP2 (WW Domain Binding Protein 2 (WBP2))

Autre désignation: WBP2 (WBP2 Produits)

Synonymes: anticorps WBP-2, anticorps MGC68743, anticorps wbp-2, anticorps zgc:109985, anticorps WW domain binding protein 2, anticorps WW domain binding protein 2 L homeolog, anticorps WBP2, anticorps Wbp2, anticorps wbp2.L, anticorps wbp2

Sujet: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding

Poids moléculaire: 28 kDa (MW of target protein)