TCAP anticorps

N° du produit ABIN632198

L’anticorps anti-TCAP Polyclonal Lapin est utilisé pour la détection de TCAP dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour TCAP anticorps (ABIN632198)

Antigène: TCAP (Titin-Cap (Telethonin) (TCAP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCAP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TCAP anticorps

Purification: Affinity purified

Immunogène: TCAP antibody was raised using a synthetic peptide corresponding to a region with amino acids CSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMRMGILGRGLQEYQLPYQR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCAP Blocking Peptide, (ABIN937196), is also available for use as a blocking control in assays to test for specificity of this TCAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCAP

Antigène: TCAP (Titin-Cap (Telethonin) (TCAP))

Autre désignation: TCAP

Sujet: Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.

Poids moléculaire: 19 kDa (MW of target protein)