Choline Kinase alpha anticorps (Middle Region)

N° du produit ABIN632201

Détail du produit anti-Choline Kinase alpha anticorps

Antigène: Choline Kinase alpha (CHKA)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Choline Kinase alpha est non-conjugé

Application: Western Blotting (WB)

Specificité: CHKA antibody was raised against the middle region of CHKA

Purification: Affinity purified

Immunogène: CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHKA Blocking Peptide, catalog no. 33R-4929, is also available for use as a blocking control in assays to test for specificity of this CHKA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHKA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Choline Kinase alpha

Antigène: Choline Kinase alpha (CHKA)

Autre désignation: CHKA (CHKA Produits)

Synonymes: anticorps im:7143625, anticorps wu:fd46h01, anticorps si:dkey-12e7.3, anticorps CHKA, anticorps chkb, anticorps ATCK1, anticorps CHOLINE KINASE, anticorps CK, anticorps F14O23.8, anticorps F14O23_8, anticorps choline kinase 1, anticorps CHK, anticorps CKI, anticorps EK, anticorps CK/EK-alpha, anticorps Chetk-alpha, anticorps Chk, anticorps ChoK, anticorps EtnK-alpha, anticorps CK-R, anticorps choline kinase alpha, anticorps choline kinase, anticorps choline kinase 1, anticorps chka, anticorps CHKA, anticorps MCYG_00090, anticorps PF14_0020, anticorps CK1, anticorps CNI01400, anticorps Chka

Sujet: The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.

Poids moléculaire: 50 kDa (MW of target protein)