GTR2 anticorps (N-Term)

N° du produit ABIN632203

Détail du produit anti-GTR2 anticorps

Antigène: GTR2 (RRAGC) (Ras-Related GTP Binding C (RRAGC))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GTR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RRAGC antibody was raised against the N terminal of RRAGC

Purification: Affinity purified

Immunogène: RRAGC antibody was raised using the N terminal of RRAGC corresponding to a region with amino acids RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RRAGC Blocking Peptide, catalog no. 33R-8180, is also available for use as a blocking control in assays to test for specificity of this RRAGC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRAGC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GTR2

Antigène: GTR2 (RRAGC) (Ras-Related GTP Binding C (RRAGC))

Autre désignation: RRAGC (RRAGC Produits)

Synonymes: anticorps GTR2, anticorps RAGC, anticorps TIB929, anticorps AU041672, anticorps Gtr2, anticorps YGR163W, anticorps RRAGC, anticorps gtr2, anticorps ragc, anticorps rragc, anticorps zgc:111971, anticorps Ras related GTP binding C, anticorps Ras-related GTP binding C, anticorps Ras related GTP binding C S homeolog, anticorps Ras-related GTP binding Ca, anticorps RRAGC, anticorps Rragc, anticorps rragc.S, anticorps rragc, anticorps rragca

Sujet: RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Autophagy