VIPAR anticorps (Middle Region)

N° du produit ABIN632204

Détail du produit anti-VIPAR anticorps

Antigène: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VIPAR est non-conjugé

Application: Western Blotting (WB)

Specificité: VIPAR antibody was raised against the middle region of VIPAR

Purification: Affinity purified

Immunogène: VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VIPAR Blocking Peptide, catalog no. 33R-9490, is also available for use as a blocking control in assays to test for specificity of this VIPAR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIPAR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VIPAR

Antigène: VIPAR (VPS33B Interacting Protein, Apical-Basolateral Polarity Regulator (VIPAR))

Autre désignation: VIPAR (VIPAR Produits)

Synonymes: anticorps C8H14orf133, anticorps VIPAR, anticorps VPS16, anticorps VPS16A, anticorps spe39, anticorps spe-39, anticorps vps16b, anticorps MGC85203, anticorps c14orf133, anticorps C14orf133, anticorps SPE-39, anticorps SPE39, anticorps VPS16B, anticorps hSPE-39, anticorps 6720456H09Rik, anticorps 9330175H22Rik, anticorps AI413782, anticorps Spe39, anticorps Vipar, anticorps si:ch211-20b12.1, anticorps vipar, anticorps wu:fb63f10, anticorps C10H14orf133, anticorps VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog, anticorps VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog L homeolog, anticorps VIPAS39, anticorps vipas39.L, anticorps vipas39, anticorps Vipas39

Sujet: This protein is involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.

Poids moléculaire: 57 kDa (MW of target protein)