ASB11 anticorps (C-Term)

N° du produit ABIN632206

Détail du produit anti-ASB11 anticorps

Antigène: ASB11 (Ankyrin Repeat and SOCS Box-Containing 11 (ASB11))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASB11 est non-conjugé

Application: Western Blotting (WB)

Specificité: ASB11 antibody was raised against the C terminal of ASB11

Purification: Affinity purified

Immunogène: ASB11 antibody was raised using the C terminal of ASB11 corresponding to a region with amino acids GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASB11 Blocking Peptide, catalog no. 33R-3519, is also available for use as a blocking control in assays to test for specificity of this ASB11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASB11

Antigène: ASB11 (Ankyrin Repeat and SOCS Box-Containing 11 (ASB11))

Autre désignation: ASB11 (ASB11 Produits)

Synonymes: anticorps ASB11, anticorps asb-a, anticorps zgc:136370, anticorps zgc:158532, anticorps DKFZp468G0324, anticorps 1110067L12Rik, anticorps 1600009D24Rik, anticorps RGD1566298, anticorps ankyrin repeat and SOCS box-containing 11, anticorps ankyrin repeat and SOCS box containing 11, anticorps ASB11, anticorps asb11, anticorps Asb11

Sujet: ASB11 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation.

Poids moléculaire: 33 kDa (MW of target protein)