C11orf65 anticorps (N-Term)

N° du produit ABIN632207

L’anticorps Lapin Polyclonal anti-C11orf65 a été validé pour WB. Il convient pour détecter C11orf65 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour C11orf65 anticorps (N-Term) (ABIN632207)

Antigène: C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C11orf65 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C11orf65 anticorps

Épitope: N-Term

Specificité: C11 ORF65 antibody was raised against the N terminal Of C11 rf65

Purification: Affinity purified

Immunogène: C11 ORF65 antibody was raised using the N terminal Of C11 rf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C11ORF65 Blocking Peptide, (ABIN5612393), is also available for use as a blocking control in assays to test for specificity of this C11ORF65 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF65 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C11orf65

Antigène: C11orf65 (Chromosome 11 Open Reading Frame 65 (C11orf65))

Autre désignation: C11ORF65

Sujet: The specific function of C11orf65 is not yet known.

Poids moléculaire: 37 kDa (MW of target protein)