HAGH anticorps (C-Term)

N° du produit ABIN632208

Cet anticorps anti-HAGH est un anticorps Lapin Polyclonal détectant HAGH dans WB. Adapté pour Humain.

Aperçu rapide pour HAGH anticorps (C-Term) (ABIN632208)

Antigène: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAGH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HAGH anticorps

Épitope: C-Term

Specificité: HAGH antibody was raised against the C terminal of HAGH

Purification: Affinity purified

Immunogène: HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HAGH Blocking Peptide, (ABIN938233), is also available for use as a blocking control in assays to test for specificity of this HAGH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAGH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HAGH

Antigène: HAGH (Hydroxyacylglutathione Hydrolase (HAGH))

Autre désignation: HAGH

Sujet: HAGH is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate.

Poids moléculaire: 29 kDa (MW of target protein)