C12ORF24 anticorps (N-Term)

N° du produit ABIN632209

Cet anticorps Lapin Polyclonal détecte spécifiquement C12ORF24 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour C12ORF24 anticorps (N-Term) (ABIN632209)

Antigène: C12ORF24 (C12orf24) (Chromosome 12 Open Reading Frame 24 (C12orf24))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C12ORF24 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-C12ORF24 anticorps

Épitope: N-Term

Specificité: C12 ORF24 antibody was raised against the N terminal Of C12 rf24

Purification: Affinity purified

Immunogène: C12 ORF24 antibody was raised using the N terminal Of C12 rf24 corresponding to a region with amino acids AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C12ORF24 Blocking Peptide, (ABIN936969), is also available for use as a blocking control in assays to test for specificity of this C12ORF24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C12ORF24

Antigène: C12ORF24 (C12orf24) (Chromosome 12 Open Reading Frame 24 (C12orf24))

Autre désignation: C12ORF24

Sujet: The function of C12orf24 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 31 kDa (MW of target protein)