Glutaredoxin 1 anticorps

N° du produit ABIN632220

Détail du produit anti-Glutaredoxin 1 anticorps

Antigène: Glutaredoxin 1 (GRX1)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glutaredoxin 1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GLRX antibody was raised using a synthetic peptide corresponding to a region with amino acids IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLRX Blocking Peptide, catalog no. 33R-4029, is also available for use as a blocking control in assays to test for specificity of this GLRX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glutaredoxin 1

Antigène: Glutaredoxin 1 (GRX1)

Autre désignation: GLRX (GRX1 Produits)

Synonymes: anticorps Glrx1, anticorps Grx, anticorps grx, anticorps wu:fc38f02, anticorps zgc:103707, anticorps GLRXL, anticorps Grx1, anticorps TTase, anticorps C86710, anticorps D13Wsu156e, anticorps grx1, anticorps GLRX, anticorps GRX, anticorps GRX1, anticorps GLRX1, anticorps TTF, anticorps glrx, anticorps glutaredoxin, anticorps glutaredoxin (thioltransferase), anticorps glutaredoxin Grx1, anticorps NrdH-redoxin, anticorps Uncharacterized monothiol glutaredoxin F10D7.3, anticorps glutaredoxin-1 (Grx1), anticorps temporal expression: late, anticorps glutaredoxin L homeolog, anticorps Glrx, anticorps glrx, anticorps GLRX, anticorps grx1, anticorps AF_RS07750, anticorps F10D7.3, anticorps AFUA_1G06100, anticorps NT01EI_2528, anticorps O2L, anticorps glrx.L

Classe de substances: Viral Protein

Sujet: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.

Poids moléculaire: 12 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis