GK2 anticorps (C-Term)

N° du produit ABIN632225

L’anticorps anti-GK2 Polyclonal Lapin est utilisé pour la détection de GK2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour GK2 anticorps (C-Term) (ABIN632225)

Antigène: GK2 (Glycerol Kinase 2 (GK2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GK2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GK2 anticorps

Épitope: C-Term

Specificité: GK2 antibody was raised against the C terminal of GK2

Purification: Affinity purified

Immunogène: GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GK2 Blocking Peptide, (ABIN5613777), is also available for use as a blocking control in assays to test for specificity of this GK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GK2

Antigène: GK2 (Glycerol Kinase 2 (GK2))

Autre désignation: GK2

Sujet: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Poids moléculaire: 61 kDa (MW of target protein)