INSL5 anticorps (Middle Region)

N° du produit ABIN632233

Cet anticorps Lapin Polyclonal détecte spécifiquement INSL5 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour INSL5 anticorps (Middle Region) (ABIN632233)

Antigène: INSL5 (Insulin-Like 5 (INSL5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp INSL5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-INSL5 anticorps

Épitope: Middle Region

Specificité: INSL5 antibody was raised against the middle region of INSL5

Purification: Affinity purified

Immunogène: INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

INSL5 Blocking Peptide, (ABIN5614203), is also available for use as a blocking control in assays to test for specificity of this INSL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur INSL5

Antigène: INSL5 (Insulin-Like 5 (INSL5))

Autre désignation: INSL5

Sujet: The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7).

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: Hormone Activity