FAM53C anticorps (N-Term)

N° du produit ABIN632235

Cet anticorps anti-FAM53C est un anticorps Lapin Polyclonal détectant FAM53C dans WB. Adapté pour Humain.

Aperçu rapide pour FAM53C anticorps (N-Term) (ABIN632235)

Antigène: FAM53C (Family with Sequence Similarity 53, Member C (FAM53C))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM53C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM53C anticorps

Épitope: N-Term

Specificité: FAM53 C antibody was raised against the N terminal of FAM53

Purification: Affinity purified

Immunogène: FAM53 C antibody was raised using the N terminal of FAM53 corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM53C Blocking Peptide, (ABIN5613490), is also available for use as a blocking control in assays to test for specificity of this FAM53C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM53C

Antigène: FAM53C (Family with Sequence Similarity 53, Member C (FAM53C))

Autre désignation: FAM53C

Sujet: The function of FAM53 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 43 kDa (MW of target protein)