KLHDC8B anticorps (N-Term)

N° du produit ABIN632243

L’anticorps Lapin Polyclonal anti-KLHDC8B a été validé pour WB. Il convient pour détecter KLHDC8B dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour KLHDC8B anticorps (N-Term) (ABIN632243)

Antigène: KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHDC8B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KLHDC8B anticorps

Épitope: N-Term

Specificité: KLHDC8 B antibody was raised against the N terminal of KLHDC8

Purification: Affinity purified

Immunogène: KLHDC8 B antibody was raised using the N terminal of KLHDC8 corresponding to a region with amino acids MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHDC8B Blocking Peptide, (ABIN5614375), is also available for use as a blocking control in assays to test for specificity of this KLHDC8B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHDC8B

Antigène: KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))

Autre désignation: KLHDC8B

Sujet: KLHDC8B contains 8 Kelch repeats. The exact function of KLHDC8B remains unknown.

Poids moléculaire: 38 kDa (MW of target protein)