IL-33 anticorps (N-Term)

N° du produit ABIN632244

Cet anticorps anti-IL-33 est un anticorps Lapin Polyclonal détectant IL-33 dans WB. Adapté pour Humain.

Aperçu rapide pour IL-33 anticorps (N-Term) (ABIN632244)

Antigène: IL-33 (IL33) (Interleukin 33 (IL33))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-33 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IL-33 anticorps

Épitope: N-Term

Specificité: IL33 antibody was raised against the N terminal of IL33

Purification: Affinity purified

Immunogène: IL33 antibody was raised using the N terminal of IL33 corresponding to a region with amino acids AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL33 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this IL33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL-33

Antigène: IL-33 (IL33) (Interleukin 33 (IL33))

Autre désignation: IL33

Sujet: Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL33 induces T helper type 2-associated cytokines.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response