TBCB anticorps (C-Term)

N° du produit ABIN632246

L’anticorps Lapin Polyclonal anti-TBCB a été validé pour WB. Il convient pour détecter TBCB dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TBCB anticorps (C-Term) (ABIN632246)

Antigène: TBCB (Tubulin Folding Cofactor B (TBCB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBCB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TBCB anticorps

Épitope: C-Term

Specificité: TBCB antibody was raised against the C terminal of TBCB

Purification: Affinity purified

Immunogène: TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBCB Blocking Peptide, (ABIN936023), is also available for use as a blocking control in assays to test for specificity of this TBCB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBCB

Antigène: TBCB (Tubulin Folding Cofactor B (TBCB))

Autre désignation: TBCB

Sujet: TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.

Poids moléculaire: 27 kDa (MW of target protein)