TRIB1 anticorps

N° du produit ABIN632249

L’anticorps Lapin Polyclonal anti-TRIB1 a été validé pour WB. Il convient pour détecter TRIB1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour TRIB1 anticorps (ABIN632249)

Antigène: TRIB1 (Tribbles Homolog 1 (TRIB1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIB1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TRIB1 anticorps

Purification: Affinity purified

Immunogène: TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIB1 Blocking Peptide, (ABIN5616774), is also available for use as a blocking control in assays to test for specificity of this TRIB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIB1

Antigène: TRIB1 (Tribbles Homolog 1 (TRIB1))

Autre désignation: TRIB1

Sujet: TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration