TRIB1 anticorps

N° du produit ABIN632249

Détail du produit anti-TRIB1 anticorps

Antigène: TRIB1 (Tribbles Homolog 1 (TRIB1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIB1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIB1 Blocking Peptide, catalog no. 33R-9035, is also available for use as a blocking control in assays to test for specificity of this TRIB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIB1

Antigène: TRIB1 (Tribbles Homolog 1 (TRIB1))

Autre désignation: TRIB1 (TRIB1 Produits)

Synonymes: anticorps TRIB1, anticorps c8fw, anticorps gig2, anticorps skip1, anticorps trb1, anticorps tribbles, anticorps C8FW, anticorps GIG2, anticorps SKIP1, anticorps TRB1, anticorps A530090O15Rik, anticorps TRB-1, anticorps Trb1, anticorps Gig2, anticorps tribbles pseudokinase 1, anticorps tribbles pseudokinase 1 L homeolog, anticorps tribbles homolog 1 (Drosophila), anticorps TRIB1, anticorps trib1, anticorps trib1.L, anticorps Trib1

Sujet: TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration