WDR66 anticorps (N-Term)

N° du produit ABIN632250

Détail du produit anti-WDR66 anticorps

Antigène: WDR66 (WD Repeat Domain 66 (WDR66))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR66 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR66 antibody was raised against the N terminal of WDR66

Purification: Affinity purified

Immunogène: WDR66 antibody was raised using the N terminal of WDR66 corresponding to a region with amino acids GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR66 Blocking Peptide, catalog no. 33R-3234, is also available for use as a blocking control in assays to test for specificity of this WDR66 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR66 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR66

Antigène: WDR66 (WD Repeat Domain 66 (WDR66))

Autre désignation: WDR66 (WDR66 Produits)

Synonymes: anticorps 4930415N18Rik, anticorps 4933428F06Rik, anticorps 5031404N07, anticorps RGD1564948, anticorps DKFZp469N2128, anticorps WD repeat domain 66, anticorps WDR66, anticorps Wdr66, anticorps wdr66

Sujet: WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.

Poids moléculaire: 130 kDa (MW of target protein)