OCIAD2 anticorps (Middle Region)

N° du produit ABIN632251

Détail du produit anti-OCIAD2 anticorps

Antigène: OCIAD2 (OCIA Domain Containing 2 (OCIAD2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OCIAD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: OCIAD2 antibody was raised against the middle region of OCIAD2

Purification: Affinity purified

Immunogène: OCIAD2 antibody was raised using the middle region of OCIAD2 corresponding to a region with amino acids QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OCIAD2 Blocking Peptide, catalog no. 33R-7576, is also available for use as a blocking control in assays to test for specificity of this OCIAD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCIAD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OCIAD2

Antigène: OCIAD2 (OCIA Domain Containing 2 (OCIAD2))

Autre désignation: OCIAD2 (OCIAD2 Produits)

Synonymes: anticorps 1810027I20Rik, anticorps OCIA domain containing 2 L homeolog, anticorps OCIA domain containing 2, anticorps ociad2.L, anticorps OCIAD2, anticorps Ociad2

Sujet: The exact function of OCIAD2 is not known.

Poids moléculaire: 17 kDa (MW of target protein)