FUNDC1 anticorps (N-Term)

N° du produit ABIN632253

Cet anticorps anti-FUNDC1 est un anticorps Lapin Polyclonal détectant FUNDC1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour FUNDC1 anticorps (N-Term) (ABIN632253)

Antigène: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FUNDC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FUNDC1 anticorps

Épitope: N-Term

Specificité: FUNDC1 antibody was raised against the N terminal of FUNDC1

Purification: Affinity purified

Immunogène: FUNDC1 antibody was raised using the N terminal of FUNDC1 corresponding to a region with amino acids MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FUNDC1 Blocking Peptide, (ABIN5613659), is also available for use as a blocking control in assays to test for specificity of this FUNDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUNDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FUNDC1

Antigène: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Autre désignation: FUNDC1

Sujet: FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.

Poids moléculaire: 17 kDa (MW of target protein)