FUNDC1 anticorps (N-Term)
-
- Antigène Voir toutes FUNDC1 Anticorps
- FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FUNDC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FUNDC1 antibody was raised against the N terminal of FUNDC1
- Purification
- Affinity purified
- Immunogène
- FUNDC1 antibody was raised using the N terminal of FUNDC1 corresponding to a region with amino acids MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV
- Top Product
- Discover our top product FUNDC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FUNDC1 Blocking Peptide, catalog no. 33R-5789, is also available for use as a blocking control in assays to test for specificity of this FUNDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUNDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))
- Autre désignation
- FUNDC1 (FUNDC1 Produits)
- Synonymes
- anticorps fundc1-a, anticorps 1500005J14Rik, anticorps 1810033P05Rik, anticorps zgc:92600, anticorps FUN14 domain-containing protein 1-like, anticorps FUN14 domain containing 1 S homeolog, anticorps FUN14 domain containing 1, anticorps LOC100357289, anticorps fundc1.S, anticorps FUNDC1, anticorps Fundc1, anticorps fundc1
- Sujet
- FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.
- Poids moléculaire
- 17 kDa (MW of target protein)
-