PEX7 anticorps (N-Term)

N° du produit ABIN632262

Cet anticorps anti-PEX7 est un anticorps Lapin Polyclonal détectant PEX7 dans WB. Adapté pour Souris et Humain.

Aperçu rapide pour PEX7 anticorps (N-Term) (ABIN632262)

Antigène: PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))

Reactivité: Souris, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEX7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PEX7 anticorps

Épitope: N-Term

Specificité: PEX7 antibody was raised against the N terminal of PEX7

Purification: Affinity purified

Immunogène: PEX7 antibody was raised using the N terminal of PEX7 corresponding to a region with amino acids MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PEX7 Blocking Peptide, (ABIN5615320), is also available for use as a blocking control in assays to test for specificity of this PEX7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PEX7

Antigène: PEX7 (Peroxisomal Biogenesis Factor 7 (PEX7))

Autre désignation: PEX7

Sujet: PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process