PRKY anticorps (N-Term)

N° du produit ABIN632264

L’anticorps Lapin Polyclonal anti-PRKY a été validé pour WB. Il convient pour détecter PRKY dans des échantillons de Humain.

Aperçu rapide pour PRKY anticorps (N-Term) (ABIN632264)

Antigène: PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKY est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PRKY anticorps

Épitope: N-Term

Specificité: PRKY antibody was raised against the N terminal of PRKY

Purification: Affinity purified

Immunogène: PRKY antibody was raised using the N terminal of PRKY corresponding to a region with amino acids MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKY Blocking Peptide, (ABIN5615565), is also available for use as a blocking control in assays to test for specificity of this PRKY antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKY

Antigène: PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))

Autre désignation: PRKY

Sujet: This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome.

Poids moléculaire: 32 kDa (MW of target protein)