TBCCD1 anticorps (N-Term)

N° du produit ABIN632270

L’anticorps Lapin Polyclonal anti-TBCCD1 a été validé pour WB. Il convient pour détecter TBCCD1 dans des échantillons de Humain.

Aperçu rapide pour TBCCD1 anticorps (N-Term) (ABIN632270)

Antigène: TBCCD1 (TBCC Domain Containing 1 (TBCCD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBCCD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TBCCD1 anticorps

Épitope: N-Term

Specificité: TBCCD1 antibody was raised against the N terminal of TBCCD1

Purification: Affinity purified

Immunogène: TBCCD1 antibody was raised using the N terminal of TBCCD1 corresponding to a region with amino acids WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBCCD1 Blocking Peptide, (ABIN5616519), is also available for use as a blocking control in assays to test for specificity of this TBCCD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBCCD1

Antigène: TBCCD1 (TBCC Domain Containing 1 (TBCCD1))

Autre désignation: TBCCD1

Sujet: The function of TBCCD1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 63 kDa (MW of target protein)