TBCCD1 anticorps (N-Term)

N° du produit ABIN632270

Détail du produit anti-TBCCD1 anticorps

Antigène: TBCCD1 (TBCC Domain Containing 1 (TBCCD1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBCCD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TBCCD1 antibody was raised against the N terminal of TBCCD1

Purification: Affinity purified

Immunogène: TBCCD1 antibody was raised using the N terminal of TBCCD1 corresponding to a region with amino acids WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBCCD1 Blocking Peptide, catalog no. 33R-9990, is also available for use as a blocking control in assays to test for specificity of this TBCCD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBCCD1

Antigène: TBCCD1 (TBCC Domain Containing 1 (TBCCD1))

Autre désignation: TBCCD1 (TBCCD1 Produits)

Synonymes: anticorps 5730478M09Rik, anticorps AU015083, anticorps BB165076, anticorps Crygs, anticorps si:ch211-194d6.5, anticorps zgc:162789, anticorps TBCC domain containing 1, anticorps TBCC domain containing 1 L homeolog, anticorps TBCCD1, anticorps Tbccd1, anticorps tbccd1.L, anticorps tbccd1

Sujet: The function of TBCCD1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 63 kDa (MW of target protein)