Allantoicase anticorps (N-Term)

N° du produit ABIN632271

Détail du produit anti-Allantoicase anticorps

Antigène: Allantoicase (ALLC)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Allantoicase est non-conjugé

Application: Western Blotting (WB)

Specificité: ALLC antibody was raised against the N terminal of ALLC

Purification: Affinity purified

Immunogène: ALLC antibody was raised using the N terminal of ALLC corresponding to a region with amino acids VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALLC Blocking Peptide, catalog no. 33R-9608, is also available for use as a blocking control in assays to test for specificity of this ALLC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALLC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Allantoicase

Antigène: Allantoicase (ALLC)

Autre désignation: ALLC (ALLC Produits)

Synonymes: anticorps PSPTO3668, anticorps ALC, anticorps 1700012B22Rik, anticorps Alc, anticorps zgc:91799, anticorps allantoicase, anticorps allantoicase L homeolog, anticorps allc, anticorps ALLC, anticorps PSPTO_3668, anticorps BPSL2945, anticorps BPSL2116, anticorps CND02340, anticorps allC, anticorps Gbro_4026, anticorps BC1002_2649, anticorps Tbis_2589, anticorps Arnit_1068, anticorps Srot_2184, anticorps Ndas_0715, anticorps Psed_1757, anticorps Sinme_4918, anticorps Allc, anticorps allc.L

Sujet: Allantoicase participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase, was lost during vertebrate evolution.

Poids moléculaire: 43 kDa (MW of target protein)