IDI1 anticorps (Middle Region)

N° du produit ABIN632278

Détail du produit anti-IDI1 anticorps

Antigène: IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IDI1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IDI1 antibody was raised against the middle region of IDI1

Purification: Affinity purified

Immunogène: IDI1 antibody was raised using the middle region of IDI1 corresponding to a region with amino acids PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IDI1 Blocking Peptide, catalog no. 33R-7208, is also available for use as a blocking control in assays to test for specificity of this IDI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IDI1

Antigène: IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))

Autre désignation: IDI1 (IDI1 Produits)

Synonymes: anticorps zgc:114138, anticorps 4832416K17Rik, anticorps ipp1, anticorps ippl1, anticorps IPP1, anticorps IPPI1, anticorps isopentenyl-diphosphate delta isomerase 1, anticorps isopentenyl-diphosphate delta isomerase, anticorps isopentenyl-diphosphate delta isomerase 1 L homeolog, anticorps idi1, anticorps Idi1, anticorps idi1.L, anticorps IDI1

Sujet: IDI1 is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.

Poids moléculaire: 32 kDa (MW of target protein)