ADHFE1 anticorps (Middle Region)

N° du produit ABIN632283

Cet anticorps anti-ADHFE1 est un anticorps Lapin Polyclonal détectant ADHFE1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ADHFE1 anticorps (Middle Region) (ABIN632283)

Antigène: ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADHFE1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADHFE1 anticorps

Épitope: Middle Region

Specificité: ADHFE1 antibody was raised against the middle region of ADHFE1

Purification: Affinity purified

Immunogène: ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADHFE1 Blocking Peptide, (ABIN5611952), is also available for use as a blocking control in assays to test for specificity of this ADHFE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADHFE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADHFE1

Antigène: ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))

Autre désignation: ADHFE1

Sujet: ADHFE1 is hydroxyacid-oxoacid transhydrogenase, which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues.

Poids moléculaire: 50 kDa (MW of target protein)