ADHFE1 anticorps (Middle Region)
-
- Antigène Voir toutes ADHFE1 Anticorps
- ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADHFE1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ADHFE1 antibody was raised against the middle region of ADHFE1
- Purification
- Affinity purified
- Immunogène
- ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS
- Top Product
- Discover our top product ADHFE1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADHFE1 Blocking Peptide, catalog no. 33R-7987, is also available for use as a blocking control in assays to test for specificity of this ADHFE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADHFE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))
- Autre désignation
- ADHFE1 (ADHFE1 Produits)
- Synonymes
- anticorps adh-8, anticorps adh8, anticorps zgc:77479, anticorps ADHFE1, anticorps ADH8, anticorps HOT, anticorps 6330565B14Rik, anticorps AI043035, anticorps Adh8, anticorps alcohol dehydrogenase, iron containing 1, anticorps alcohol dehydrogenase, iron containing, 1, anticorps alcohol dehydrogenase, iron containing 1 S homeolog, anticorps adhfe1, anticorps ADHFE1, anticorps adhfe1.S, anticorps Adhfe1
- Sujet
- ADHFE1 is hydroxyacid-oxoacid transhydrogenase, which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues.
- Poids moléculaire
- 50 kDa (MW of target protein)
-